PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0036s0300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 520aa    MW: 57008.4 Da    PI: 7.6426
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0036s0300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.4e-33195251259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          dDgynWrKYGqK+vkgse+prsYY+Ct++gCp+kkkvers  d++++ei+Y+g+Hnh 
  Kaladp0036s0300.2.p 195 DDGYNWRKYGQKQVKGSENPRSYYKCTFPGCPTKKKVERSL-DGDITEIVYKGSHNHA 251
                          8****************************************.***************7 PP

2WRKY105.72.4e-33364422159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  Kaladp0036s0300.2.p 364 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHD 422
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-29185253IPR003657WRKY domain
SuperFamilySSF1182901.44E-25188253IPR003657WRKY domain
PROSITE profilePS5081124.03189253IPR003657WRKY domain
SMARTSM007744.7E-36194252IPR003657WRKY domain
PfamPF031063.4E-25195250IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37349424IPR003657WRKY domain
SuperFamilySSF1182902.62E-29356424IPR003657WRKY domain
PROSITE profilePS5081138.377359424IPR003657WRKY domain
SMARTSM007743.1E-39364423IPR003657WRKY domain
PfamPF031068.1E-26365422IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MAASSANSPF SLSPSFMNNS FSDLLNSPSA VAPGDDSTLL NGSVNRGAPK FKSLHPPSLL  60
PVSPTPASPS SYFAFPPGLS PSELLDSPVL LTSSYLLPSP TTGSFPAAQP HNWRSLSVSG  120
QHDVKPEDSR NQNNTSSYSD FTFQPELRTV SQPWNFKSYQ SQQKTDSISN ERVSGDYSSY  180
QPAPIQSVRE ARRSDDGYNW RKYGQKQVKG SENPRSYYKC TFPGCPTKKK VERSLDGDIT  240
EIVYKGSHNH AKPQSTRRSA SNGSHPMQHV NGELQAQEHS VGSQMVANQL SDHSAATPEN  300
SSVSVGDDDR SSSRRVGDDK LDDDEPDPKR WKRENEGEIM SAPGCRAVRE PRVVVQTTSD  360
IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TNPGCPVRKH VERASHDLRA VITTYEGKHN  420
HDVPAARGSG SHSRQAAANN SCVTNSTHHQ SSTGQPAAAQ QAPFTLEMLH GPESFGFGNP  480
VSAYNNVNGR QQNPDCSVFP RTKEEPREDQ FLESICYAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37185425878Probable WRKY transcription factor 4
2lex_A2e-37185425878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0539942e-54BT053994.1 Zea mays full-length cDNA clone ZM_BFc0103O21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142085.11e-174hypothetical protein PHAVU_008G251300g
SwissprotQ8S8P51e-109WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLV7B8C11e-174V7B8C1_PHAVU; Uncharacterized protein
STRINGGLYMA14G38010.11e-169(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-100WRKY DNA-binding protein 33